Difference between revisions of "Tutorial"

From victor
Jump to: navigation, search
(Target/Template alignment)
Line 43: Line 43:
 
==Sequence to sequence alignment==
 
==Sequence to sequence alignment==
  
==Build loops==
 
  
==Evaluate a model==
+
=Evaluate 3D models=
 +
 
 +
=Build loops=

Revision as of 11:07, 20 August 2014

In the sample folder are available all input and output files used in this tutorial.

Target/Template alignment

Introduction

Supposing you have already found a template candidate, you need to align it against your target sequence. In this dummy example we take the sequences of two homologous proteins both endowed with 3D structure. That allows us to compare different type of Victor alignments with the "exact" one derived from the structural alignment.

The two proteins are:

  • Target = 2ANL (chain A)
  • Template = 1DP5 (chain A)

The two structure superimpose quite well (RMSD 2.03 A) considering the low level of sequence identity (28.06%). This is the resulting sequence alignment after the 3D alignment done by FATCAT:

3d align.png

Alignment cartoon.png

rigth


The subali application let you choose from very different type of algorithms, strategies and parameters. The fist step is to put the target and the template fasta sequences together in a single file like that:

>2ANL:A Target
SENDVIELDDVANLMFYGEGEVGDNHQKFMLIFDTGSANLWVPSKKCNSIGCSTKHLYDSSKSKSYEKDGTKVEITYGSG
TVRGFFSKDLVTLGYLSLPYKFIEVTDTDDLEPLYTAAEFDGILGLGWKDLSIGSIDPIVVELKNQNKIDQALFTFYLPV
HDKHSGYLTIGGIEEKFYEGELTYEKLNHDLFWQVDLDVNFGKTSMEKANVIVDSGTSTITAPTSFINKFFKDLNVIKVP
FLPFYITTCNNKDMPTLEFKSANNTYTLEPEYYMEPLLDIDDTLCMLYILPVDIDKNTFILGDPFMRKYFTVFDYDKESI
GFAVAKN
>1DP5:A Template
GGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGS
LEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTS
KDTENGGEATFGGIDESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLITLPSGLAEMINAEIGA
KKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGN
NAVGLAKAI


Sequence to sequence alignment

Evaluate 3D models

Build loops