NB: The data will be kept for two weeks, after which it will be deleted without further notice.

Title: spP61769.fasta

Emailaddress: none

Process ID: 158821071



Sequence profiles:
Your input parameters: HTML
Fasta sequences (amino, aggregation, disorder, secondary structure): TXT
Aggregation profile (with probability): DAT
Aggregation free energy: DAT
Disorder Prediction (with probability): TXT
Secondary structure (with probability): TXT
Pairing :
Matrix: DAT
best pairings: DAT

Sequence
Pairing description
Symbol color code
1        10        20        30        40        
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGF
DDDDDDOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
CCHHHHHHHHHHHHHHCHHHHHCCCCBBBBBBCCCCCCCCCBBBBBBBCC
---PPPPPPPPPPPPPPP----------------------PPPPPPP---
51 60 70 80 90 HPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYAC OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO CCCCBBBBBBCCCCBBBBBBBCCCCCCCCCBBBBBBBBBCCCCCCCCBBB -----------------------------PPPPPPPPP------------
101 110 RVNHVTLSQPKIVKWDRDM OOOOOOOOOOOOOOOODDD BBBBBBBCCCCBBBBCCCC -PPPPPPP-----------

Pairing parallel 1: Energy -5.624364 pairing segments 5-15 and 5-15 (size 11)
Pairing parallel 2: Energy -5.533557 pairing segments 5-13 and 5-13 (size 9)
Pairing parallel 3: Energy -4.958453 pairing segments 4-15 and 4-15 (size 12)
Pairing parallel 4: Energy -4.958453 pairing segments 5-16 and 5-16 (size 12)
Pairing parallel 5: Energy -4.867646 pairing segments 4-13 and 4-13 (size 10)
Pairing parallel 6: Energy -4.867646 pairing segments 5-14 and 5-14 (size 10)
Pairing parallel 7: Energy -4.776838 pairing segments 5-12 and 5-12 (size 8)
Pairing parallel 8: Energy -4.74108 pairing segments 102-107 and 102-107 (size 6)
Pairing parallel 9: Energy -4.520683 pairing segments 5-10 and 5-10 (size 6)
Pairing parallel 10: Energy -4.380205 pairing segments 5-18 and 5-18 (size 14)
Pairing antiparallel 11: Energy -4.319047 pairing segments 81-88 and 88-81 (size 8)
Pairing parallel 12: Energy -4.292542 pairing segments 4-16 and 4-16 (size 13)
Pairing parallel 13: Energy -4.201734 pairing segments 4-14 and 4-14 (size 11)
Pairing antiparallel 14: Energy -4.156373 pairing segments 81-87 and 88-82 (size 7)
Pairing antiparallel 15: Energy -4.156373 pairing segments 82-88 and 87-81 (size 7)
Pairing parallel 16: Energy -4.132605 pairing segments 42-47 and 42-47 (size 6)
Pairing parallel 17: Energy -4.120742 pairing segments 7-15 and 7-15 (size 9)
Pairing parallel 18: Energy -4.110927 pairing segments 4-12 and 4-12 (size 9)
Pairing parallel 19: Energy -4.110628 pairing segments 41-47 and 41-47 (size 7)
Pairing parallel 20: Energy -4.075169 pairing segments 102-108 and 102-108 (size 7)
Pairing parallel 21: Energy -4.029934 pairing segments 7-13 and 7-13 (size 7)
Pairing parallel 22: Energy -4.020602 pairing segments 80-88 and 80-88 (size 9)
   
  • P: Parallel aggregation
  • A: Anti-parallel aggregation
  • -: Non aggregating residue
  • D: Disordered residue
  • O: Ordered residue
  • H: α-Helix residue
  • B: β-strand residue
  • C: Coiled residue
  • Pairing x in green above threshold
  • Disorder and aggregation probability profiles


    Higher resolution pdf



    Data links

    Disorder data

    Aggregation data

    Helix and aggregation probability profiles


    Higher resolution pdf

    Strand and aggregation probability profiles


    Higher resolution pdf

    Coil and aggregation probability profiles


    Higher resolution pdf




    Data links

    Secondary structure data

    Aggregation data