Below are links to sample output of the PASTA 2.0 server.

Example 1 Three proteins self aggregating and co-aggregating. The fibril formation of the sequences have been studied previously:

  • HETs prion
  • human beta amyloid
  • human Alpha-synuclein

Example 2 Human beta amyloid. Mutation of Methionine (M) position 35 in DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV to Valine (V) increases fibril potential.
An important section is the "Free energy graphs and data" where you can see the free energy decreasing because of the Valine mutation. Although the energies have increased no new regions have emerged.

Example 3 Is a peptide from alpha synuclein aggregation prone or not. The peptide is EQVTNVGGAVVTGVTAVA. Top = 1 and the energy must be less than -5 Pasta Energy Units (PEU).

Example 4 Beta2-microglobulin in this case the user wants to find aggregating regions. In this example we show the server output with high confidence region detection (specificity 90%): top=22 and Energy<2.8.

Example 5 Beta2-microglobulin in this case the user wants to find aggregating regions. In this example we show the server output with lower confidence region detection (specificity 90%): top=44 and Energy<1.4.